1.67 Rating by ClearWebStats
anaragroup.com is 7 years 7 months 6 days old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, anaragroup.com is SAFE to browse.
Get Custom Widget

Traffic Report of Anaragroup

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
36
Siteadvisor Rating
View anaragroup.com site advisor rating Not Applicable

Where is anaragroup.com server located?

Hosted IP Address:

103.24.202.75 View other site hosted with anaragroup.com

Hosted Country:

anaragroup.com hosted country NL anaragroup.com hosted country

Location Latitude:

52.374

Location Longitude:

4.88969

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View anaragroup.com HTML resources

Homepage Links Analysis

.:: Anara Group ::.

Website Inpage Analysis

H1 Headings: 8 H2 Headings: 5
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 14
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 103.24.202.75)

.:: Kuchipudi dance classes in Dallas, Texas, Indian Classical dance classes in DFW, Abhinaya Kuchipudi Dance Academy ::.

anaragroup.com favicon - akdanceacademy.com

Indian Classical dance classes in DFW,Indian Classical dance classes in texas,Abhinaya Kuchipudi Dance Academy, Kalyani Avula, Kuchipudi, Kuchipudi Dance, Texas , Kuchipudi Dance, Frisco ,Kuchipudi Dance, Flower Mound, Kuchipudi Dance, Plano,Kuchipudi Dance, Irving,Indian Classical Dance, Texas,Indian Classical Dance, Frisco, Indian Classical Dance, Flower Mound, Indian Classical Dance, Plano, Indian Classical Dance, Irving, Indian Classical...

View anaragroup.com Pagerank   anaragroup.com alexa rank Not Applicable   anaragroup.com website value $ 8.95

Chilli India

anaragroup.com favicon - chilliindia.com.au

View anaragroup.com Pagerank   anaragroup.com alexa rank 19,798,671   anaragroup.com website value $ 8.95

Index of /

anaragroup.com favicon - proventureimpex.com

View anaragroup.com Pagerank   anaragroup.com alexa rank Not Applicable   anaragroup.com website value $ 8.95

.:: Indian Olympaids ::.

anaragroup.com favicon - indianolympiads.com

View anaragroup.com Pagerank   anaragroup.com alexa rank Not Applicable   anaragroup.com website value $ 8.95

.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

anaragroup.com favicon - srisubrahmanyaswamydevalayamskandagiri.org

View anaragroup.com Pagerank   anaragroup.com alexa rank 1,178,223   anaragroup.com website value $ 720.00

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 12 Oct 2016 03:42:43 GMT
Server: Apache
Last-Modified: Wed, 31 Aug 2016 12:51:28 GMT
Accept-Ranges: bytes
Content-Length: 23298
Content-Type: text/html

Domain Information for anaragroup.com

Domain Registrar: PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM anaragroup.com registrar info
Registration Date: 2016-10-08 7 years 7 months 6 days ago
Last Modified: 2016-08-10 7 years 9 months 2 days ago
Expiration Date: 2017-10-08 6 years 7 months 5 days ago

Domain Nameserver Information

Host IP Address Country
ns1.outline.co.in anaragroup.com name server information 103.24.202.179 anaragroup.com server is located in India India
ns2.outline.co.in anaragroup.com name server information 103.24.202.179 anaragroup.com server is located in India India

DNS Record Analysis

Host Type TTL Extra
anaragroup.com A 14400 IP:103.24.202.75
anaragroup.com NS 86400 Target:ns1.yellowsoft.in
anaragroup.com NS 86400 Target:ns2.yellowsoft.in
anaragroup.com NS 86400 Target:ns2.outline.co.in
anaragroup.com NS 86400 Target:ns1.outline.co.in
anaragroup.com SOA 86400 MNAME:ns1.outline.co.in
RNAME:info.lazybulls.com
Serial:2016081008
Refresh:3600
Retry:7200
Expire:1209600
anaragroup.com MX 14400 Priority:1
Target:ASPMX.L.GOOGLE.com
anaragroup.com MX 14400 Priority:10
Target:ALT3.ASPMX.L.GOOGLE.com
anaragroup.com MX 14400 Priority:10
Target:ALT4.ASPMX.L.GOOGLE.com
anaragroup.com MX 14400 Priority:5
Target:ALT1.ASPMX.L.GOOGLE.com
anaragroup.com MX 14400 Priority:5
Target:ALT2.ASPMX.L.GOOGLE.com

Similarly Ranked Websites to Anaragroup

Google

anaragroup.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View anaragroup.com Pagerank   Alexa rank for anaragroup.com 1   website value of anaragroup.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

anaragroup.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View anaragroup.com Pagerank   Alexa rank for anaragroup.com 1   website value of anaragroup.com $ 8,833,062,960.00

Gmail

anaragroup.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View anaragroup.com Pagerank   Alexa rank for anaragroup.com 1   website value of anaragroup.com $ 8,833,062,960.00

Android Apps on Google Play

anaragroup.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View anaragroup.com Pagerank   Alexa rank for anaragroup.com 1   website value of anaragroup.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

anaragroup.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View anaragroup.com Pagerank   Alexa rank for anaragroup.com 1   website value of anaragroup.com $ 8,833,062,960.00

Full WHOIS Lookup for anaragroup.com

Domain Name: ANARAGROUP.COM
Registry Domain ID: 2051270415_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2016-10-10T02:24:36Z
Creation Date: 2016-08-10T18:44:19Z
Registrar Registration Expiration Date: 2017-08-10T18:44:19Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Abdul Rahman Mohammed
Registrant Organization: Anara Security Solutions
Registrant Street: B64, F6, P S Nagar Masab Tank Road
Registrant City: Hyderabad
Registrant State/Province: Telangana
Registrant Postal Code: 500057
Registrant Country: IN
Registrant Phone: +91.8096374408
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: [email protected]
Registry Admin ID: Not Available From Registry
Admin Name: Abdul Rahman Mohammed
Admin Organization: Anara Security Solutions
Admin Street: B64, F6, P S Nagar Masab Tank Road
Admin City: Hyderabad
Admin State/Province: Telangana
Admin Postal Code: 500057
Admin Country: IN
Admin Phone: +91.8096374408
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: [email protected]
Registry Tech ID: Not Available From Registry
Tech Name: Abdul Rahman Mohammed
Tech Organization: Anara Security Solutions
Tech Street: B64, F6, P S Nagar Masab Tank Road
Tech City: Hyderabad
Tech State/Province: Telangana
Tech Postal Code: 500057
Tech Country: IN
Tech Phone: +91.8096374408
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: [email protected]
Name Server: ns1.outline.co.in
Name Server: ns2.outline.co.in
DNSSEC:Unsigned
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2016-10-12T03:42:57Z